Cyclophilin F (PPIF) mouse monoclonal antibody, clone AT1F5, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Cyclophilin F (PPIF) mouse monoclonal antibody, clone AT1F5, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal anti-PPIF antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPIF. |
Cyclophilin F (PPIF) mouse monoclonal antibody, clone AT1F5, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Cyclophilin F (PPIF) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 102-131 amino acids from the Central region of Human Cyclophilin F. |
Rabbit Polyclonal Anti-PPIF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPIF antibody: synthetic peptide directed towards the middle region of human PPIF. Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody,clone OTI1C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody, clone OTI7D12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody,clone OTI6E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIF mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PPIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPIF |
PPIF rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPIF |
PPIF Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-207 of human PPIF (NP_005720.1). |
Modifications | Unmodified |
Cyclophilin F Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Cyclophilin F |
Cyclophilin F Rabbit monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody,clone OTI1C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI1C4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI1C4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody,clone OTI1C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody,clone OTI7D12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI7D12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI7D12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody,clone OTI7D12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody,clone OTI6E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI6E7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody,clone OTI6E7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody,clone OTI6E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI1A1 (formerly 1A1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI4D3 (formerly 4D3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI4D3 (formerly 4D3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPIF mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPIF mouse monoclonal antibody, clone OTI1G8 (formerly 1G8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPIF mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |