Rabbit Polyclonal PRCC Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PRCC Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-PRCC Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Prcc antibody is: synthetic peptide directed towards the C-terminal region of Rat Prcc. Synthetic peptide located within the following region: KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PRCC mouse monoclonal antibody,clone OTI5G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PRCC mouse monoclonal antibody,clone OTI5H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
PRCC mouse monoclonal antibody,clone OTI5G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRCC mouse monoclonal antibody,clone OTI5G7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRCC mouse monoclonal antibody,clone OTI5G7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
PRCC mouse monoclonal antibody,clone OTI5G7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
PRCC mouse monoclonal antibody,clone OTI5H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRCC mouse monoclonal antibody,clone OTI5H7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PRCC mouse monoclonal antibody,clone OTI5H7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
PRCC mouse monoclonal antibody,clone OTI5H7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |