Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A8 Antibody: synthetic peptide directed towards the middle region of human SLC7A8. Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A8 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC7A8. Synthetic peptide located within the following region: NNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGI

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2).
Modifications Unmodified

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), Biotinylated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated