ALK mouse monoclonal antibody, clone OTI1A4
Applications | IHC, LMNX, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ALK mouse monoclonal antibody, clone OTI1A4
Applications | IHC, LMNX, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-ZO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli. |
Carrier-free (BSA/glycerol-free) CD1C mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
lL-17 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C17
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700015 |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CEA (CEACAM5) mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700041 |
KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTLA4 mouse monoclonal antibody,clone UMAB249
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-ERCC1 mouse monoclonal antibody, clone 4F9
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
CD36 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F4
Applications | ELISA, LMNX |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700031 |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
MCP-1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5D3
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700025 |
Carrier-free (BSA/glycerol-free) CD20 mouse monoclonal antibody,clone UMAB38
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Mouse monoclonal anti-HEF1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Biotinylated Anti-Human IL-21 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-21 |
lL-10 Rat monoclonal antibody, ELISA and Luminex validated, clone OTI9D7
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700017 |
Mouse anti-PROM1 (CD133) monoclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Mouse Monoclonal ApoE4 Antibody (4E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal Anti-NGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NGF |
Goat Polyclonal Anti-CANX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli. |
Carrier-free (BSA/glycerol-free) LGR4 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700023 |
IL-8 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone SNAP8
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700024 |