Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
.jpg?d=110x100 "User supplied image")
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GFAP Capture mouse monoclonal antibody, Luminex validated, clone OTI4D11
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700041 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Active filters
Category
- Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Availabilities
- In Stock
Filter by
Target Symbol
- ALK (114)
- VSNL1 (108)
- KLK8 (99)
- PDCD1 (91)
- MAP2K1 (86)
- TP53 (83)
- ERBB2 (79)
- CD4 (78)
- CDKN2A (78)
- CD5 (74)
- JUN (74)
- EGFR (73)
- NME1 (73)
- PGR (68)
- ABCB1 (64)
- GLI1 (62)
- MAP2K3 (62)
- MKI67 (62)
- NBN (58)
- CTAG1B (55)
- ERCC1 (55)
- PECAM1 (55)
- GADD45G (53)
- MSMB (53)
- VIM (53)
- CD68 (52)
- MDM2 (52)
- CD274 (51)
- CTNNB1 (51)
- EPCAM (51)
- OTC (50)
- TG (50)
- LIPG (47)
- TOP2A (47)
- KRT19 (46)
- NKX3-1 (46)
- CD99 (45)
- PIK3C2A (44)
- ADIPOQ (43)
- CD44 (43)
- LGALS3 (43)
- PCNA (43)
- CFI (42)
- NUMB (42)
- BRAF (41)
- SENP2 (41)
- AFP (39)
- MAPK13 (39)
- MS4A1 (39)
- MLANA (38)
- PTPRC (38)
- VWF (38)
- CD40 (37)
- NKX2-1 (36)
- KRT20 (35)
- SERPINB3 (35)
- AKT1 (34)
- MDM4 (34)
- TYMS (34)
- CHGA (33)
- F13A1 (33)
- TNFRSF8 (33)
- BTLA (32)
- CD63 (32)
- FGFR2 (32)
- UBE2E3 (32)
- KIT (31)
- MLH1 (31)
- NR3C1 (31)
- PDCD1LG2 (31)
- PROCR (31)
- SYP (31)
- LGR5 (30)
- MTOR (30)
- NCAM1 (30)
- TACC2 (30)
- CBX8 (29)
- CD163 (29)
- CD19 (29)
- ERG (29)
- SNAI2 (29)
- UBA52 (29)
- AFAP1 (28)
- APP (28)
- FTCD (28)
- HAVCR2 (28)
- IDO1 (28)
- RTRAF (28)
- BCL10 (27)
- BCL2 (27)
- CD33 (27)
- CD80 (27)
- ESR1 (27)
- FOXO1 (27)
- GFAP (27)
- MAPT (27)
- MIEN1 (27)
- MUC1 (27)
- S100A9 (27)
- TMEM173 (27)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (18907)
- Transmembrane (6821)
- Transcription Factors (5170)
- Secreted Protein (2995)
- ES Cell Differentiation/IPS (2502)
- Protein Kinase (2375)
- Protease (1300)
- Stem cell - Pluripotency (1216)
- Adult stem cells (627)
- Nuclear Hormone Receptor (445)
- Embryonic stem cells (418)
- GPCR (361)
- Phosphatase (328)
- Cancer stem cells (316)
- Induced pluripotent stem cells (218)
- Stem cell relevant signaling - JAK/STAT signaling pathway (218)
- Stem cell relevant signaling - DSL/Notch pathway (192)
- Ion Channels: Other (149)
- P450 (130)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (92)
- Ion Channels: Potassium (53)
- Stem cell relevant signaling - Wnt Signaling pathway (53)
- Ion Channels: Transient receptor potential (41)
- Ion Channels: Glutamate Receptors (33)
- Ion Channels: Cys-loop Receptors (26)
- Ion Channels: Sodium (17)
- Ion Channels: Calcium (9)
- Ion Channels: Cyclic nucleotide gated (7)
- Ion Channels: ATP Receptors (1)
Pathways
- Metabolic pathways (2619)
- Pathways in cancer (2556)
- MAPK signaling pathway (1671)
- Focal adhesion (1347)
- Prostate cancer (1221)
- T cell receptor signaling pathway (1074)
- Neurotrophin signaling pathway (1050)
- Colorectal cancer (996)
- Cytokine-cytokine receptor interaction (991)
- ErbB signaling pathway (971)
- Regulation of actin cytoskeleton (951)
- Cell adhesion molecules (CAMs) (946)
- Pancreatic cancer (929)
- Melanoma (927)
- Chronic myeloid leukemia (900)
- Toll-like receptor signaling pathway (897)
- Glioma (873)
- Cell cycle (824)
- Bladder cancer (823)
- Non-small cell lung cancer (812)
- Endometrial cancer (802)
- Insulin signaling pathway (788)
- B cell receptor signaling pathway (764)
- Hematopoietic cell lineage (743)
- Chemokine signaling pathway (729)
- Progesterone-mediated oocyte maturation (728)
- Endocytosis (718)
- GnRH signaling pathway (699)
- Apoptosis (671)
- Acute myeloid leukemia (662)
- Jak-STAT signaling pathway (658)
- Wnt signaling pathway (657)
- Leukocyte transendothelial migration (651)
- Renal cell carcinoma (650)
- Fc epsilon RI signaling pathway (645)
- Natural killer cell mediated cytotoxicity (621)
- Small cell lung cancer (603)
- p53 signaling pathway (587)
- Fc gamma R-mediated phagocytosis (574)
- VEGF signaling pathway (574)
- Alzheimer's disease (567)
- Adherens junction (545)
- Gap junction (521)
- Calcium signaling pathway (518)
- Oocyte meiosis (507)
- Amyotrophic lateral sclerosis (ALS) (481)
- Epithelial cell signaling in Helicobacter pylori infection (480)
- Melanogenesis (478)
- Huntington's disease (465)
- Thyroid cancer (459)
- Ubiquitin mediated proteolysis (458)
- Adipocytokine signaling pathway (453)
- Purine metabolism (422)
- Axon guidance (419)
- mTOR signaling pathway (403)
- Tight junction (390)
- Long-term potentiation (387)
- Neuroactive ligand-receptor interaction (374)
- Long-term depression (371)
- Pyrimidine metabolism (371)
- Vascular smooth muscle contraction (368)
- Type II diabetes mellitus (367)
- NOD-like receptor signaling pathway (346)
- Complement and coagulation cascades (339)
- RIG-I-like receptor signaling pathway (339)
- Basal cell carcinoma (323)
- Pathogenic Escherichia coli infection (322)
- Primary immunodeficiency (304)
- Parkinson's disease (300)
- TGF-beta signaling pathway (300)
- Lysosome (270)
- Systemic lupus erythematosus (269)
- Prion diseases (263)
- Dorso-ventral axis formation (255)
- ECM-receptor interaction (254)
- Antigen processing and presentation (243)
- Cytosolic DNA-sensing pathway (241)
- Viral myocarditis (236)
- Arginine and proline metabolism (235)
- Glycolysis / Gluconeogenesis (231)
- Dilated cardiomyopathy (225)
- Hedgehog signaling pathway (225)
- Hypertrophic cardiomyopathy (HCM) (225)
- Autoimmune thyroid disease (221)
- Nucleotide excision repair (216)
- PPAR signaling pathway (215)
- Oxidative phosphorylation (210)
- Phosphatidylinositol signaling system (203)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (194)
- Type I diabetes mellitus (192)
- Valine (184)
- Tryptophan metabolism (180)
- leucine and isoleucine degradation (180)
- Allograft rejection (178)
- Graft-versus-host disease (161)
- Lysine degradation (160)
- Glycerolipid metabolism (159)
- Metabolism of xenobiotics by cytochrome P450 (156)
- RNA degradation (156)
- Drug metabolism - cytochrome P450 (155)
- Inositol phosphate metabolism (154)
- Notch signaling pathway (154)
- Spliceosome (154)
- Arachidonic acid metabolism (149)
- Alanine (148)
- aspartate and glutamate metabolism (148)
- Proteasome (145)
- ABC transporters (142)
- Olfactory transduction (142)
- Mismatch repair (140)
- DNA replication (137)
- Fatty acid metabolism (137)
- Tyrosine metabolism (131)
- Base excision repair (130)
- Histidine metabolism (130)
- Propanoate metabolism (130)
- Vibrio cholerae infection (127)
- One carbon pool by folate (126)
- Glutathione metabolism (123)
- Cardiac muscle contraction (119)
- Butanoate metabolism (118)
- Pyruvate metabolism (118)
- Homologous recombination (109)
- Renin-angiotensin system (108)
- Retinol metabolism (102)
- Maturity onset diabetes of the young (95)
- beta-Alanine metabolism (95)
- Drug metabolism - other enzymes (94)
- Fructose and mannose metabolism (88)
- Ribosome (88)
- Asthma (84)
- Circadian rhythm - mammal (84)
- Glycine (83)
- serine and threonine metabolism (83)
- SNARE interactions in vesicular transport (79)
- Glycerophospholipid metabolism (77)
- Amino sugar and nucleotide sugar metabolism (76)
- Citrate cycle (TCA cycle) (73)
- Cysteine and methionine metabolism (73)
- Linoleic acid metabolism (73)
- Starch and sucrose metabolism (72)
- Sphingolipid metabolism (70)
- Nitrogen metabolism (69)
- Pentose phosphate pathway (65)
- Regulation of autophagy (64)
- Primary bile acid biosynthesis (62)
- Nicotinate and nicotinamide metabolism (60)
- Porphyrin and chlorophyll metabolism (58)
- Taste transduction (55)
- Other glycan degradation (54)
- RNA polymerase (54)
- Folate biosynthesis (50)
- Aminoacyl-tRNA biosynthesis (49)
- Galactose metabolism (49)
- Sulfur metabolism (49)
- Fatty acid elongation in mitochondria (46)
- Basal transcription factors (44)
- N-Glycan biosynthesis (44)
- Methane metabolism (42)
- Non-homologous end-joining (42)
- Caffeine metabolism (41)
- Androgen and estrogen metabolism (40)
- Ether lipid metabolism (40)
- Ascorbate and aldarate metabolism (38)
- Terpenoid backbone biosynthesis (38)
- Phenylalanine metabolism (35)
- Selenoamino acid metabolism (31)
- Glycosaminoglycan degradation (30)
- Glyoxylate and dicarboxylate metabolism (29)
- Limonene and pinene degradation (28)
- Thiamine metabolism (26)
- Biosynthesis of unsaturated fatty acids (24)
- Cyanoamino acid metabolism (22)
- C21-Steroid hormone metabolism (21)
- Riboflavin metabolism (21)
- alpha-Linolenic acid metabolism (21)
- Fatty acid biosynthesis (20)
- Synthesis and degradation of ketone bodies (20)
- Pantothenate and CoA biosynthesis (18)
- Keratan sulfate biosynthesis (16)
- Pentose and glucuronate interconversions (16)
- Taurine and hypotaurine metabolism (16)
- Glycosphingolipid biosynthesis - ganglio series (15)
- Glycosphingolipid biosynthesis - lacto and neolacto series (15)
- Steroid biosynthesis (12)
- Vitamin B6 metabolism (10)
- D-Glutamine and D-glutamate metabolism (9)
- Glycosphingolipid biosynthesis - globo series (9)
- leucine and isoleucine biosynthesis (9)
- O-Glycan biosynthesis (8)
- Phenylalanine (7)
- tyrosine and tryptophan biosynthesis (7)
- Chondroitin sulfate biosynthesis (6)
- Protein export (6)
- Heparan sulfate biosynthesis (5)
- Lysine biosynthesis (4)
- Ubiquinone and other terpenoid-quinone biosynthesis (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Biotin metabolism (1)
- O-Mannosyl glycan biosynthesis (1)