Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 399.00
In Stock
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight633 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 633 |
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CADH6 antibody for SISCAPA, clone OTIR5A6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 550 conjugated
| Reactivities | Human, Mouse |
| Conjugation | DyLight 550 |
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- ERBB2 (107)
- KLK8 (100)
- PDCD1 (91)
- CD4 (79)
- CD5 (75)
- EGFR (73)
- ABCB1 (64)
- PECAM1 (57)
- EPCAM (53)
- MSMB (53)
- CD68 (52)
- CD274 (51)
- CD99 (45)
- CD44 (43)
- MLANA (41)
- PTPRC (41)
- MS4A1 (40)
- CD40 (37)
- FGFR2 (35)
- LGR5 (35)
- TNFRSF8 (33)
- BTLA (32)
- CD19 (32)
- CD63 (32)
- KIT (31)
- PDCD1LG2 (31)
- PROCR (31)
- SYP (31)
- CD33 (30)
- NCAM1 (30)
- CD163 (29)
- HP (29)
- MUC1 (29)
- APP (28)
- BCL2 (28)
- HAVCR2 (28)
- CD80 (27)
- CD1C (25)
- CDH1 (25)
- FGG (25)
- L1CAM (25)
- MSR1 (25)
- RET (25)
- ANO1 (24)
- MET (24)
- SPG7 (24)
- TNF (24)
- CTLA4 (23)
- ERBB3 (23)
- FBXW7 (23)
- WFDC2 (23)
- CA12 (22)
- FOLH1 (22)
- PDGFRB (22)
- APMAP (21)
- BSG (21)
- CYP1A2 (21)
- FCGR2A (21)
- ICAM3 (21)
- MSLN (21)
- PCDH7 (21)
- PDGFRA (21)
- PMEL (21)
- SYT4 (21)
- CD2 (20)
- NPR3 (20)
- ACE2 (19)
- CD22 (19)
- CD47 (19)
- ENG (19)
- FATE1 (19)
- FCER2 (19)
- MME (19)
- PTPRE (19)
- WNT3 (19)
- CD86 (18)
- FGFR1 (18)
- TAPBPL (18)
- UBE2J1 (18)
- VCAM1 (18)
- CDH2 (17)
- CR2 (17)
- GOLM1 (17)
- GPNMB (17)
- IL10RA (17)
- MCAM (17)
- MTDH (17)
- NEU1 (17)
- BNIP1 (16)
- CD34 (16)
- CD36 (16)
- CD79B (16)
- CLDN6 (16)
- LRRC25 (16)
- PLAAT3 (16)
- POMK (16)
- RNF144B (16)
- TNFRSF9 (16)
- CD27 (15)
- CSF2RB (15)
Reactivities
- Human (6906)
- Mouse (3158)
- Rat (2853)
- Monkey (230)
- Dog (211)
- Bovine (28)
- Canine (28)
- Pig (28)
- Gorilla (24)
- Cow (20)
- Rabbit (16)
- Gibbon (15)
- Chicken (10)
- Horse (10)
- Hamster (9)
- Zebrafish (9)
- Chimpanzee (7)
- Orang-Utan (6)
- Bat (5)
- Guinea Pig (4)
- Rhesus Monkey (3)
- Sheep (3)
- Xenopus (3)
- Porcine (2)
- Primate (2)
- X. tropicalis (2)
- Fish (1)
- Goat (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Cell adhesion molecules (CAMs) (924)
- Cytokine-cytokine receptor interaction (726)
- Hematopoietic cell lineage (677)
- Pathways in cancer (629)
- Focal adhesion (379)
- Calcium signaling pathway (374)
- Endocytosis (366)
- Prostate cancer (325)
- T cell receptor signaling pathway (304)
- Adherens junction (302)
- Metabolic pathways (283)
- MAPK signaling pathway (280)
- Neuroactive ligand-receptor interaction (275)
- Regulation of actin cytoskeleton (260)
- ErbB signaling pathway (238)
- Colorectal cancer (233)
- Primary immunodeficiency (232)
- Bladder cancer (225)
- Leukocyte transendothelial migration (222)
- Pancreatic cancer (216)
- Melanoma (215)
- Endometrial cancer (213)
- Non-small cell lung cancer (189)
- Systemic lupus erythematosus (177)
- Toll-like receptor signaling pathway (164)
- Alzheimer's disease (162)
- Jak-STAT signaling pathway (152)
- Apoptosis (151)
- Gap junction (150)
- Allograft rejection (137)
- Glioma (137)
- ECM-receptor interaction (135)
- Axon guidance (134)
- Autoimmune thyroid disease (132)
- Epithelial cell signaling in Helicobacter pylori infection (129)
- ABC transporters (126)
- Viral myocarditis (125)
- Lysosome (121)
- Antigen processing and presentation (118)
- Melanogenesis (106)
- Amyotrophic lateral sclerosis (ALS) (104)
- GnRH signaling pathway (103)
- Natural killer cell mediated cytotoxicity (101)
- Type I diabetes mellitus (99)
- Graft-versus-host disease (96)
- B cell receptor signaling pathway (95)
- Olfactory transduction (91)
- Fc gamma R-mediated phagocytosis (88)
- Neurotrophin signaling pathway (82)
- Dorso-ventral axis formation (77)
- Dilated cardiomyopathy (76)
- Asthma (75)
- Huntington's disease (75)
- Hypertrophic cardiomyopathy (HCM) (73)
- Basal cell carcinoma (71)
- Complement and coagulation cascades (70)
- Renin-angiotensin system (70)
- Parkinson's disease (68)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (67)
- Adipocytokine signaling pathway (65)
- Tight junction (64)
- Drug metabolism - cytochrome P450 (62)
- Wnt signaling pathway (61)
- SNARE interactions in vesicular transport (60)
- TGF-beta signaling pathway (57)
- Thyroid cancer (57)
- Small cell lung cancer (56)
- Pathogenic Escherichia coli infection (54)
- Hedgehog signaling pathway (53)
- Chemokine signaling pathway (52)
- Prion diseases (47)
- Retinol metabolism (47)
- RIG-I-like receptor signaling pathway (46)
- Linoleic acid metabolism (44)
- Type II diabetes mellitus (43)
- Vascular smooth muscle contraction (43)
- Oxidative phosphorylation (42)
- Ubiquitin mediated proteolysis (42)
- Metabolism of xenobiotics by cytochrome P450 (41)
- PPAR signaling pathway (41)
- Renal cell carcinoma (38)
- N-Glycan biosynthesis (37)
- Acute myeloid leukemia (36)
- NOD-like receptor signaling pathway (35)
- Tryptophan metabolism (34)
- Fc epsilon RI signaling pathway (32)
- Long-term potentiation (32)
- Arachidonic acid metabolism (31)
- Caffeine metabolism (31)
- Cardiac muscle contraction (31)
- Nitrogen metabolism (30)
- Sphingolipid metabolism (28)
- p53 signaling pathway (28)
- Chronic myeloid leukemia (27)
- Long-term depression (27)
- Purine metabolism (24)
- Fatty acid metabolism (23)
- Oocyte meiosis (21)
- Taste transduction (21)
- Insulin signaling pathway (19)
- Progesterone-mediated oocyte maturation (19)
- Glycerolipid metabolism (18)
- Notch signaling pathway (18)
- Porphyrin and chlorophyll metabolism (18)
- Vibrio cholerae infection (18)
- Other glycan degradation (17)
- Cytosolic DNA-sensing pathway (16)
- Drug metabolism - other enzymes (16)
- Glutathione metabolism (15)
- Glycosphingolipid biosynthesis - lacto and neolacto series (15)
- Nicotinate and nicotinamide metabolism (15)
- VEGF signaling pathway (15)
- Pyrimidine metabolism (14)
- Tyrosine metabolism (14)
- Keratan sulfate biosynthesis (13)
- Androgen and estrogen metabolism (12)
- Ascorbate and aldarate metabolism (12)
- Riboflavin metabolism (12)
- Glycerophospholipid metabolism (11)
- Propanoate metabolism (11)
- Valine (11)
- leucine and isoleucine degradation (11)
- Arginine and proline metabolism (10)
- Histidine metabolism (10)
- Lysine degradation (10)
- Butanoate metabolism (9)
- Glycolysis / Gluconeogenesis (9)
- Limonene and pinene degradation (9)
- Primary bile acid biosynthesis (9)
- Pyruvate metabolism (9)
- beta-Alanine metabolism (9)
- Ether lipid metabolism (8)
- Steroid biosynthesis (8)
- Biosynthesis of unsaturated fatty acids (7)
- O-Glycan biosynthesis (7)
- Amino sugar and nucleotide sugar metabolism (6)
- Phosphatidylinositol signaling system (5)
- Starch and sucrose metabolism (5)
- Chondroitin sulfate biosynthesis (4)
- Protein export (4)
- C21-Steroid hormone metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Heparan sulfate biosynthesis (3)
- Inositol phosphate metabolism (3)
- Pentose and glucuronate interconversions (3)
- Cell cycle (2)
- Cyanoamino acid metabolism (2)
- Glycine (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Pantothenate and CoA biosynthesis (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- alpha-Linolenic acid metabolism (2)
- serine and threonine metabolism (2)
- Base excision repair (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Phenylalanine metabolism (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)