Antibodies

View as table Download

Rabbit Polyclonal Anti-CTSL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTSL

Rabbit Polyclonal Anti-MMP12 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MMP12

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Rabbit Polyclonal Anti-USP25 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen USP25 antibody was raised against a 17 amino acid peptide near the center of human USP25.

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Rabbit polyclonal anti-MBTPS1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1.

Rabbit Polyclonal Anti-KLK1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLK1

Rabbit Polyclonal Anti-ST14 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ST14

Rabbit polyclonal MMP-2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-2.

Rabbit Polyclonal Anti-CAPN7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAPN7

Rabbit Polyclonal Anti-CFLAR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CFLAR

USD 320.00

In Stock

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%).

Rabbit Polyclonal Anti-MMP14 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MMP14

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-MMP9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MMP9

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HGF

Rabbit Polyclonal Anti-MMP16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MMP16

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Rabbit Polyclonal antibody to Factor X (coagulation factor X)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 33 and 312 of Factor X (Uniprot ID#P00742)

Rabbit polyclonal anti-MMP-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-1 antibody.

Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PPGB

F12 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human F12

Goat Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1.

Rabbit polyclonal antibody to CLN2 (tripeptidyl peptidase I)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 224 and 563 of CLN2 (Uniprot ID#O14773)

Rabbit polyclonal anti-MASP2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MASP2.

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP.

Rabbit Polyclonal Caspase-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1.

Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8)

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.

Rabbit polyclonal anti-GRAK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRAK.

FURIN Rabbit Polyclonal (aa740-790) Antibody

Applications IHC
Reactivities Bovine, Chimpanzee, Human, Monkey, Mouse, Rat, Dog, Horse
Immunogen FURIN antibody was raised against a portion of amino acids 740-790 of human Furin was used as the immunogen.

Anti-ACR rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 407-421 amino acids of human acrosin

Rabbit Polyclonal Cathepsin V Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal FLIP Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLIP antibody was raised against a 19 amino acid peptide near the carboxy terminus of human FLIP. The immunogen is located within amino acids 180 - 230 of FLIP.

Rabbit Polyclonal antibody to TPP1 (tripeptidyl peptidase I)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 66 and 324 of TPP1 (Uniprot ID#O14773)

Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930)

Rabbit polyclonal anti-MMP-10 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MMP-10.

Rabbit polyclonal anti-MMP-19 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-19.

Rabbit polyclonal anti-SENP5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human SENP5.

Rabbit polyclonal anti-ATG4C antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4C.

Rabbit polyclonal anti-USP19 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP19.

Rabbit polyclonal anti-MMP-14 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-14.

Rabbit polyclonal Neprilysin Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin.

Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125
Modifications Phospho-specific

Rabbit polyclonal DJ-1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DJ-1.

Rabbit Polyclonal Cathepsin D Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal TSP50 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.