Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CADH6 antibody for SISCAPA, clone OTIR5A6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- KLK8 (99)
- PDCD1 (91)
- ERBB2 (79)
- CD4 (78)
- CD5 (74)
- EGFR (73)
- ABCB1 (64)
- PECAM1 (55)
- MSMB (53)
- CD68 (52)
- CD274 (51)
- EPCAM (51)
- CD99 (45)
- CD44 (43)
- MS4A1 (39)
- MLANA (38)
- PTPRC (38)
- CD40 (37)
- TNFRSF8 (33)
- BTLA (32)
- CD63 (32)
- FGFR2 (32)
- KIT (31)
- PDCD1LG2 (31)
- PROCR (31)
- SYP (31)
- LGR5 (30)
- NCAM1 (30)
- CD163 (29)
- CD19 (29)
- APP (28)
- HAVCR2 (28)
- BCL2 (27)
- CD33 (27)
- CD80 (27)
- MUC1 (27)
- CD1C (25)
- HP (25)
- L1CAM (25)
- MSR1 (25)
- RET (25)
- ANO1 (24)
- CDH1 (24)
- FGG (24)
- MET (24)
- SPG7 (24)
- CTLA4 (23)
- ERBB3 (23)
- FBXW7 (23)
- FOLH1 (22)
- PDGFRB (22)
- APMAP (21)
- BSG (21)
- FCGR2A (21)
- ICAM3 (21)
- MSLN (21)
- PCDH7 (21)
- PDGFRA (21)
- PMEL (21)
- SYT4 (21)
- TNF (21)
- CD2 (20)
- CYP1A2 (20)
- NPR3 (20)
- ACE2 (19)
- CA12 (19)
- CD47 (19)
- FATE1 (19)
- FCER2 (19)
- MME (19)
- PTPRE (19)
- WFDC2 (19)
- WNT3 (19)
- CD86 (18)
- FGFR1 (18)
- TAPBPL (18)
- UBE2J1 (18)
- CD22 (17)
- CDH2 (17)
- CR2 (17)
- GPNMB (17)
- IL10RA (17)
- MTDH (17)
- NEU1 (17)
- VCAM1 (17)
- BNIP1 (16)
- CD34 (16)
- CD79B (16)
- CLDN6 (16)
- LRRC25 (16)
- MCAM (16)
- PLAAT3 (16)
- POMK (16)
- TNFRSF9 (16)
- CD27 (15)
- CSF2RB (15)
- ENG (15)
- GOLM1 (15)
- GPAT3 (15)
- GPR17 (15)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (912)
- Cytokine-cytokine receptor interaction (714)
- Hematopoietic cell lineage (656)
- Pathways in cancer (594)
- Endocytosis (362)
- Focal adhesion (349)
- Calcium signaling pathway (345)
- T cell receptor signaling pathway (296)
- Prostate cancer (292)
- Metabolic pathways (279)
- Adherens junction (273)
- MAPK signaling pathway (272)
- Neuroactive ligand-receptor interaction (268)
- Regulation of actin cytoskeleton (256)
- Colorectal cancer (232)
- Primary immunodeficiency (224)
- Leukocyte transendothelial migration (219)
- Melanoma (213)
- ErbB signaling pathway (209)
- Bladder cancer (194)
- Pancreatic cancer (187)
- Endometrial cancer (183)
- Systemic lupus erythematosus (172)
- Non-small cell lung cancer (160)
- Alzheimer's disease (158)
- Toll-like receptor signaling pathway (158)
- Jak-STAT signaling pathway (150)
- Gap junction (149)
- Apoptosis (146)
- Glioma (136)
- Axon guidance (134)
- Allograft rejection (133)
- Autoimmune thyroid disease (131)
- ECM-receptor interaction (130)
- Epithelial cell signaling in Helicobacter pylori infection (128)
- ABC transporters (125)
- Viral myocarditis (124)
- Lysosome (121)
- Antigen processing and presentation (117)
- Melanogenesis (106)
- GnRH signaling pathway (103)
- Amyotrophic lateral sclerosis (ALS) (99)
- Natural killer cell mediated cytotoxicity (98)
- Type I diabetes mellitus (96)
- Graft-versus-host disease (93)
- B cell receptor signaling pathway (90)
- Olfactory transduction (90)
- Fc gamma R-mediated phagocytosis (84)
- Neurotrophin signaling pathway (81)
- Dorso-ventral axis formation (77)
- Huntington's disease (75)
- Dilated cardiomyopathy (72)
- Basal cell carcinoma (71)
- Asthma (70)
- Renin-angiotensin system (70)
- Complement and coagulation cascades (69)
- Hypertrophic cardiomyopathy (HCM) (69)
- Parkinson's disease (67)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (66)
- Tight junction (64)
- Drug metabolism - cytochrome P450 (60)
- SNARE interactions in vesicular transport (60)
- Wnt signaling pathway (60)
- Adipocytokine signaling pathway (56)
- Thyroid cancer (56)
- Small cell lung cancer (55)
- TGF-beta signaling pathway (54)
- Hedgehog signaling pathway (53)
- Pathogenic Escherichia coli infection (53)
- Chemokine signaling pathway (49)
- Prion diseases (47)
- Retinol metabolism (45)
- Vascular smooth muscle contraction (43)
- Linoleic acid metabolism (42)
- Ubiquitin mediated proteolysis (42)
- Oxidative phosphorylation (41)
- RIG-I-like receptor signaling pathway (40)
- Type II diabetes mellitus (40)
- Metabolism of xenobiotics by cytochrome P450 (39)
- Renal cell carcinoma (38)
- N-Glycan biosynthesis (37)
- Acute myeloid leukemia (36)
- PPAR signaling pathway (36)
- Tryptophan metabolism (33)
- Long-term potentiation (32)
- NOD-like receptor signaling pathway (31)
- Arachidonic acid metabolism (30)
- Caffeine metabolism (30)
- Cardiac muscle contraction (30)
- Fc epsilon RI signaling pathway (28)
- Sphingolipid metabolism (28)
- p53 signaling pathway (28)
- Chronic myeloid leukemia (27)
- Long-term depression (27)
- Nitrogen metabolism (27)
- Fatty acid metabolism (23)
- Purine metabolism (23)
- Oocyte meiosis (21)
- Taste transduction (21)
- Insulin signaling pathway (19)
- Progesterone-mediated oocyte maturation (19)
- Glycerolipid metabolism (18)
- Notch signaling pathway (18)
- Porphyrin and chlorophyll metabolism (18)
- Vibrio cholerae infection (18)
- Other glycan degradation (17)
- Drug metabolism - other enzymes (15)
- Glutathione metabolism (15)
- Glycosphingolipid biosynthesis - lacto and neolacto series (15)
- Nicotinate and nicotinamide metabolism (15)
- VEGF signaling pathway (15)
- Cytosolic DNA-sensing pathway (14)
- Pyrimidine metabolism (14)
- Tyrosine metabolism (14)
- Keratan sulfate biosynthesis (13)
- Androgen and estrogen metabolism (12)
- Ascorbate and aldarate metabolism (12)
- Riboflavin metabolism (12)
- Glycerophospholipid metabolism (11)
- Propanoate metabolism (11)
- Valine (11)
- leucine and isoleucine degradation (11)
- Arginine and proline metabolism (10)
- Histidine metabolism (10)
- Lysine degradation (10)
- Butanoate metabolism (9)
- Glycolysis / Gluconeogenesis (9)
- Limonene and pinene degradation (9)
- Primary bile acid biosynthesis (9)
- Pyruvate metabolism (9)
- beta-Alanine metabolism (9)
- Ether lipid metabolism (8)
- Steroid biosynthesis (8)
- O-Glycan biosynthesis (7)
- Amino sugar and nucleotide sugar metabolism (6)
- Biosynthesis of unsaturated fatty acids (6)
- Phosphatidylinositol signaling system (5)
- Starch and sucrose metabolism (5)
- Chondroitin sulfate biosynthesis (4)
- Protein export (4)
- C21-Steroid hormone metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Heparan sulfate biosynthesis (3)
- Inositol phosphate metabolism (3)
- Pentose and glucuronate interconversions (3)
- Cell cycle (2)
- Cyanoamino acid metabolism (2)
- Glycine (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Pantothenate and CoA biosynthesis (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- alpha-Linolenic acid metabolism (2)
- serine and threonine metabolism (2)
- Base excision repair (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Phenylalanine metabolism (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)