Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
USD 379.00
In Stock
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
USD 515.00
In Stock
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PPGB |
F12 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F12 |
USD 379.00
In Stock
Goat Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Rabbit polyclonal anti-MASP2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MASP2. |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal FLIP Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FLIP antibody was raised against a peptide corresponding to amino acids near the C-terminus of human FLIPaFLIPl form. The immunogen is located within the last 50 amino acids of FLIP. |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Active filters
Families
- Protease
Availabilities
- In Stock
Filter by
Target Symbol
- CFI (42)
- SENP2 (41)
- HP (29)
- EPHX1 (24)
- MMP13 (24)
- SPG7 (24)
- FOLH1 (22)
- NAPSA (22)
- MALT1 (21)
- MMP3 (20)
- USP44 (20)
- LTA4H (19)
- MME (19)
- PSMA6 (19)
- KLK3 (18)
- CTSL (17)
- MIPEP (17)
- CFLAR (16)
- PSMA7 (16)
- CASP3 (15)
- CPM (15)
- PPAT (14)
- PSMA2 (14)
- USP40 (14)
- ACY1 (13)
- DPP9 (13)
- ENPEP (13)
- OTUB1 (13)
- PROZ (13)
- C1S (12)
- CAPN5 (12)
- MASP2 (12)
- MGLL (12)
- CAPN9 (11)
- F10 (11)
- MMP7 (11)
- PRTN3 (11)
- PSMB9 (11)
- ADAMTS1 (10)
- AGTPBP1 (10)
- CPA1 (10)
- CPA2 (10)
- HGF (10)
- OTUB2 (10)
- PLAU (10)
- UQCRC1 (10)
- ANPEP (9)
- DPP3 (9)
- F12 (9)
- NLN (9)
- PSMB7 (9)
- USP36 (9)
- USP7 (9)
- ADAMTS4 (8)
- HABP2 (8)
- MMP11 (8)
- MMP2 (8)
- UCHL1 (8)
- CASP7 (7)
- CASP9 (7)
- CLPP (7)
- ERAP1 (7)
- GZMB (7)
- PSMB4 (7)
- USP5 (7)
- C1R (6)
- CNDP1 (6)
- CTSD (6)
- TFR2 (6)
- TMPRSS5 (6)
- ACE (5)
- ATG4B (5)
- CAPN2 (5)
- CASP4 (5)
- CASP8 (5)
- CPO (5)
- KYNU (5)
- SENP1 (5)
- SIL1 (5)
- USP10 (5)
- USP12 (5)
- USP25 (5)
- ADAMTS8 (4)
- CASP1 (4)
- CASP2 (4)
- DPP4 (4)
- ECE1 (4)
- F2 (4)
- KEL (4)
- LONRF3 (4)
- PARK7 (4)
- PGC (4)
- PLG (4)
- PSMA4 (4)
- SEC11A (4)
- SENP8 (4)
- USP13 (4)
- USP16 (4)
- YME1L1 (4)
- ACR (3)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Complement and coagulation cascades (123)
- Metabolic pathways (91)
- Proteasome (86)
- Alzheimer's disease (83)
- Pathways in cancer (69)
- Lysosome (64)
- Apoptosis (62)
- Renin-angiotensin system (59)
- Wnt signaling pathway (54)
- Parkinson's disease (45)
- Huntington's disease (38)
- Hematopoietic cell lineage (31)
- Viral myocarditis (27)
- p53 signaling pathway (27)
- Amyotrophic lateral sclerosis (ALS) (26)
- Prostate cancer (25)
- Metabolism of xenobiotics by cytochrome P450 (24)
- Systemic lupus erythematosus (23)
- Colorectal cancer (22)
- Natural killer cell mediated cytotoxicity (22)
- Arachidonic acid metabolism (21)
- B cell receptor signaling pathway (21)
- T cell receptor signaling pathway (21)
- Antigen processing and presentation (20)
- Epithelial cell signaling in Helicobacter pylori infection (19)
- Focal adhesion (15)
- MAPK signaling pathway (15)
- Alanine (14)
- Bladder cancer (14)
- Purine metabolism (14)
- aspartate and glutamate metabolism (14)
- Arginine and proline metabolism (13)
- Glycerolipid metabolism (12)
- Cardiac muscle contraction (11)
- Glutathione metabolism (11)
- Leukocyte transendothelial migration (11)
- NOD-like receptor signaling pathway (11)
- Oxidative phosphorylation (11)
- Cytokine-cytokine receptor interaction (10)
- GnRH signaling pathway (10)
- Melanoma (10)
- Renal cell carcinoma (10)
- Neuroactive ligand-receptor interaction (9)
- Regulation of autophagy (8)
- Type I diabetes mellitus (8)
- Allograft rejection (7)
- Autoimmune thyroid disease (7)
- Endometrial cancer (7)
- Graft-versus-host disease (7)
- Non-small cell lung cancer (7)
- Pancreatic cancer (7)
- RIG-I-like receptor signaling pathway (7)
- Small cell lung cancer (7)
- VEGF signaling pathway (7)
- Histidine metabolism (6)
- beta-Alanine metabolism (6)
- Hypertrophic cardiomyopathy (HCM) (5)
- Notch signaling pathway (5)
- Toll-like receptor signaling pathway (5)
- Tryptophan metabolism (5)
- Cytosolic DNA-sensing pathway (4)
- Protein export (4)
- Regulation of actin cytoskeleton (4)
- Endocytosis (3)
- Hedgehog signaling pathway (3)
- PPAR signaling pathway (3)
- Basal transcription factors (2)
- Cyanoamino acid metabolism (2)
- Neurotrophin signaling pathway (2)
- Other glycan degradation (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Folate biosynthesis (1)
- Spliceosome (1)