Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CADH6 antibody for SISCAPA, clone OTIR5A6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Goat Polyclonal Antibody against ABCC8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Isotypes
- IgG
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (18)
- FGFR1 (9)
- GRIN2B (9)
- MET (9)
- ERBB2 (8)
- IGF1R (7)
- BCL2L1 (6)
- CSF1R (6)
- EPHA2 (6)
- GJA1 (6)
- NGFR (6)
- PDGFRB (6)
- APP (5)
- CD19 (5)
- CD44 (5)
- GRIN1 (5)
- GRM3 (5)
- STX1A (5)
- SYT1 (5)
- BAX (4)
- CANX (4)
- CAV1 (4)
- CDH1 (4)
- CFTR (4)
- CLDN1 (4)
- CLDN7 (4)
- EPHA3 (4)
- FZD8 (4)
- GLRA1 (4)
- INSR (4)
- KDR (4)
- KIT (4)
- NOTCH2 (4)
- NTRK2 (4)
- PTPRC (4)
- SPAG4 (4)
- TNF (4)
- TRPC6 (4)
- ABCD4 (3)
- ACE (3)
- ACVR1C (3)
- APLNR (3)
- APLP2 (3)
- AQP1 (3)
- AQP2 (3)
- AQP3 (3)
- ATP1A1 (3)
- BMPR2 (3)
- CA14 (3)
- CASR (3)
- CCR5 (3)
- CDH23 (3)
- CHRM1 (3)
- CLDN10 (3)
- CLDN5 (3)
- CNGA2 (3)
- CSF2RA (3)
- EDA (3)
- EDNRA (3)
- EFNB1 (3)
- EIF2AK3 (3)
- EPHB1 (3)
- F10 (3)
- FGFR2 (3)
- FZD3 (3)
- FZD4 (3)
- GABRB1 (3)
- GJB6 (3)
- GRIK1 (3)
- GRIN2C (3)
- GRM4 (3)
- HAVCR1 (3)
- HCRTR1 (3)
- IGF2R (3)
- IL27 (3)
- ITGB3 (3)
- KCNA5 (3)
- LPAR3 (3)
- LPAR4 (3)
- MME (3)
- MUC1 (3)
- NTRK1 (3)
- PTGER2 (3)
- SCN11A (3)
- SLC32A1 (3)
- SLC44A1 (3)
- SSTR4 (3)
- STEAP4 (3)
- SYT11 (3)
- TNFRSF21 (3)
- TNFSF13 (3)
- TRAF3IP3 (3)
- TRPC3 (3)
- TRPM7 (3)
- VTCN1 (3)
- A4GNT (2)
- ABCB5 (2)
- ABCB6 (2)
- ABCC8 (2)
- ABHD12 (2)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (180)
- Cytokine-cytokine receptor interaction (159)
- Pathways in cancer (159)
- Calcium signaling pathway (106)
- Endocytosis (89)
- Focal adhesion (84)
- Metabolic pathways (81)
- Colorectal cancer (79)
- Adherens junction (76)
- MAPK signaling pathway (72)
- Regulation of actin cytoskeleton (72)
- Cell adhesion molecules (CAMs) (71)
- Hematopoietic cell lineage (63)
- Melanoma (60)
- Alzheimer's disease (59)
- Prostate cancer (58)
- Axon guidance (56)
- Gap junction (47)
- Pancreatic cancer (45)
- Melanogenesis (43)
- Amyotrophic lateral sclerosis (ALS) (41)
- Leukocyte transendothelial migration (39)
- ErbB signaling pathway (38)
- Wnt signaling pathway (37)
- Glioma (36)
- Jak-STAT signaling pathway (36)
- Huntington's disease (35)
- ABC transporters (34)
- Bladder cancer (34)
- Endometrial cancer (32)
- Epithelial cell signaling in Helicobacter pylori infection (32)
- Basal cell carcinoma (31)
- GnRH signaling pathway (29)
- Non-small cell lung cancer (29)
- Dilated cardiomyopathy (28)
- Apoptosis (27)
- Long-term potentiation (26)
- Hypertrophic cardiomyopathy (HCM) (25)
- Vascular smooth muscle contraction (25)
- ECM-receptor interaction (24)
- Tight junction (24)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (23)
- Neurotrophin signaling pathway (23)
- Chemokine signaling pathway (22)
- Dorso-ventral axis formation (22)
- TGF-beta signaling pathway (22)
- SNARE interactions in vesicular transport (18)
- Natural killer cell mediated cytotoxicity (17)
- Systemic lupus erythematosus (17)
- Toll-like receptor signaling pathway (17)
- Chronic myeloid leukemia (16)
- Long-term depression (16)
- Hedgehog signaling pathway (15)
- Primary immunodeficiency (15)
- Small cell lung cancer (15)
- Adipocytokine signaling pathway (14)
- Oocyte meiosis (14)
- Renal cell carcinoma (14)
- Renin-angiotensin system (14)
- Parkinson's disease (13)
- Pathogenic Escherichia coli infection (13)
- Progesterone-mediated oocyte maturation (13)
- T cell receptor signaling pathway (13)
- Type II diabetes mellitus (13)
- Oxidative phosphorylation (12)
- Lysosome (11)
- Notch signaling pathway (11)
- Retinol metabolism (11)
- p53 signaling pathway (11)
- Cardiac muscle contraction (10)
- Purine metabolism (10)
- Viral myocarditis (10)
- Arachidonic acid metabolism (9)
- Complement and coagulation cascades (9)
- Fc gamma R-mediated phagocytosis (9)
- N-Glycan biosynthesis (9)
- Thyroid cancer (9)
- Antigen processing and presentation (8)
- B cell receptor signaling pathway (8)
- Glycerolipid metabolism (8)
- Metabolism of xenobiotics by cytochrome P450 (8)
- PPAR signaling pathway (8)
- Taste transduction (8)
- Vibrio cholerae infection (8)
- Acute myeloid leukemia (7)
- Drug metabolism - cytochrome P450 (7)
- Fc epsilon RI signaling pathway (7)
- Glycerophospholipid metabolism (7)
- Insulin signaling pathway (7)
- Allograft rejection (6)
- Asthma (6)
- Graft-versus-host disease (6)
- Prion diseases (6)
- Riboflavin metabolism (6)
- Type I diabetes mellitus (6)
- Ether lipid metabolism (5)
- Linoleic acid metabolism (5)
- Nitrogen metabolism (5)
- RIG-I-like receptor signaling pathway (5)
- Autoimmune thyroid disease (4)
- Glutathione metabolism (4)
- NOD-like receptor signaling pathway (4)
- Porphyrin and chlorophyll metabolism (4)
- Sphingolipid metabolism (4)
- Steroid biosynthesis (4)
- Tryptophan metabolism (4)
- Tyrosine metabolism (4)
- VEGF signaling pathway (4)
- Androgen and estrogen metabolism (3)
- Biosynthesis of unsaturated fatty acids (3)
- Chondroitin sulfate biosynthesis (3)
- Drug metabolism - other enzymes (3)
- Fatty acid metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Heparan sulfate biosynthesis (3)
- Inositol phosphate metabolism (3)
- Nicotinate and nicotinamide metabolism (3)
- Phosphatidylinositol signaling system (3)
- Primary bile acid biosynthesis (3)
- Starch and sucrose metabolism (3)
- Cell cycle (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Keratan sulfate biosynthesis (2)
- O-Glycan biosynthesis (2)
- Olfactory transduction (2)
- Pantothenate and CoA biosynthesis (2)
- Propanoate metabolism (2)
- Pyrimidine metabolism (2)
- Ubiquitin mediated proteolysis (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Ascorbate and aldarate metabolism (1)
- C21-Steroid hormone metabolism (1)
- Caffeine metabolism (1)
- Cyanoamino acid metabolism (1)
- Cytosolic DNA-sensing pathway (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- Selenoamino acid metabolism (1)
- Taurine and hypotaurine metabolism (1)
- Terpenoid backbone biosynthesis (1)