Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-DKK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DKK2 |
Goat Anti-CAMK2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTAQSEETRVWHR, from the internal region of the protein sequence according to NP_057065.2; NP_741960.1. |
Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MAP3K7 (Thr187) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MAP3K7 around the phosphorylation site of Threonine 187 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NFAT4 around the phosphorylation site of Serine 165 |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
| Modifications | Phospho-specific |
USD 379.00
In Stock
Active filters
Pathways
- Wnt signaling pathway
Availabilities
- In Stock
Filter by
Category
Target Symbol
- TP53 (83)
- JUN (74)
- CTNNB1 (53)
- SENP2 (41)
- WNT3 (19)
- MYC (17)
- SOX17 (16)
- CCND2 (14)
- DVL2 (14)
- CAMK2B (13)
- CCND1 (13)
- MAPK8 (12)
- CHP1 (11)
- MAPK9 (11)
- MMP7 (11)
- PPP2R5D (10)
- PRKCA (10)
- CSNK1E (9)
- APC (8)
- BTRC (8)
- CAMK2A (7)
- CTBP2 (7)
- MAP3K7 (7)
- SMAD2 (7)
- PPARD (6)
- PPP2R1B (6)
- SMAD3 (6)
- CCND3 (5)
- FOSL1 (5)
- MAPK10 (5)
- CTBP1 (4)
- FZD8 (4)
- NFATC3 (4)
- RAC1 (4)
- SFRP2 (4)
- TTK (4)
- CSNK1A1 (3)
- FZD1 (3)
- FZD3 (3)
- FZD4 (3)
- NFATC2 (3)
- PRKACG (3)
- PRKCB (3)
- PRKCG (3)
- RHOA (3)
- ROCK1 (3)
- ROCK2 (3)
- TBL1XR1 (3)
- CREBBP (2)
- CSNK2A1 (2)
- CSNK2B (2)
- DKK2 (2)
- DKK4 (2)
- EP300 (2)
- FZD10 (2)
- FZD2 (2)
- LEF1 (2)
- LRP5 (2)
- LRP6 (2)
- NFAT5 (2)
- NFATC4 (2)
- PPP3CA (2)
- PPP3CB (2)
- PRKACA (2)
- PRKX (2)
- PSEN1 (2)
- SFRP1 (2)
- SKP1 (2)
- TBL1X (2)
- VANGL1 (2)
- VANGL2 (2)
- WNT10A (2)
- WNT2B (2)
- WNT4 (2)
- WNT5B (2)
- WNT8A (2)
- AXIN1 (1)
- AXIN2 (1)
- CAMK2D (1)
- CAMK2G (1)
- CHP2 (1)
- CSNK1A1L (1)
- CTNNBIP1 (1)
- CUL1 (1)
- CXXC4 (1)
- DAAM1 (1)
- DKK1 (1)
- DVL3 (1)
- FZD5 (1)
- FZD6 (1)
- FZD7 (1)
- FZD9 (1)
- GSK3B (1)
- NLK (1)
- PLCB3 (1)
- PORCN (1)
- PPP2CA (1)
- PPP2CB (1)
- PPP2R5A (1)
- PPP2R5B (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (591)
- Transcription Factors (303)
- ES Cell Differentiation/IPS (215)
- Stem cell - Pluripotency (120)
- Protein Kinase (108)
- Transmembrane (61)
- Protease (54)
- Stem cell relevant signaling - Wnt Signaling pathway (54)
- Secreted Protein (51)
- Stem cell relevant signaling - JAK/STAT signaling pathway (43)
- Embryonic stem cells (30)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (30)
- Cancer stem cells (29)
- Phosphatase (24)
- Induced pluripotent stem cells (21)
- GPCR (16)
- Adult stem cells (15)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Nuclear Hormone Receptor (6)