Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS |
Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, ChiChickenen |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins |
Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit Polyclonal Anti-Vinculin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin. |
Germany
Japan
United Kingdom
China
