Antibodies

Jump to Filters
View as table Download
Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody
TA316680

USD 425.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA317650

USD 425.00

In Stock

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA347934

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5.
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA311880

USD 345.00

4 Weeks

Rabbit polyclonal anti-EDG2 / LPAR1 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG2.
Modifications Phospho-specific
HTR2C Rabbit Polyclonal Antibody
TA313299

USD 345.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA313441

USD 345.00

4 Weeks

Rabbit polyclonal anti-ADRB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB1 .
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA310064

USD 205.00

3 Weeks

Rabbit anti-LPAR1 polyclonal antibody

Applications WB
Reactivities Human, Bovine, Murine, Rat, Ovine
Conjugation Unconjugated
Immunogen Human LPA 1 amino acids 342-359
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA341637

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
HTR2C Goat Polyclonal Antibody
TA303035

USD 375.00

5 Days

Goat Polyclonal Antibody against HTR2C

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1.
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA311805

USD 345.00

4 Weeks

Rabbit polyclonal anti-DRD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internalof human DRD1.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA311868

USD 345.00

4 Weeks

Rabbit polyclonal anti-GRM1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRM1.
DRD2
TA316681

USD 484.00

5 Days

Dopamine D2 Receptor (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Dog, Gorilla, Human, Rabbit, Horse (Predicted: Monkey, Pig)
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Ferret, Bat, Bovine, Dog, Elephant, Panda, Horse, Rabbit (100%); Gibbon, Monkey, Pig (94%); Marmoset (81%).
5 HT 2A (HTR2A) Rabbit Polyclonal Antibody
TA330446

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2A antibody: synthetic peptide directed towards the N terminal of human HTR2A. Synthetic peptide located within the following region: DILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSEN
HTR2C Rabbit Polyclonal Antibody
TA330447

USD 310.00

5 Days

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA321176

USD 345.00

4 Weeks

Anti-ADRB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Beta-1 adrenergic receptor
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA321199

USD 345.00

4 Weeks

Anti-DRD1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA321200

USD 345.00

4 Weeks

Anti-DRD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321217

USD 345.00

4 Weeks

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321218

USD 345.00

In Stock

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
EDG2 (LPAR1) Rabbit Polyclonal Antibody
TA350844

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-LPAR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPAR1
HTR2C Rabbit Polyclonal Antibody
TA350954

USD 345.00

In Stock

Rabbit Polyclonal Anti-HTR2C Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA890123

USD 345.00

In Stock

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA890123S

USD 159.00

2 Days

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5