Antibodies

Jump to Filters
View as table Download
PPP2R1A Rabbit Polyclonal Antibody
TA332922

USD 275.00

3 Weeks

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A
PPP2R5B Goat Polyclonal Antibody
TA302424

USD 375.00

In Stock

Goat Polyclonal Antibody against B56 beta isoform

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRLTPQVAASGGQS, from the C Terminus of the protein sequence according to NP_006235.1.
PPP3CB Rabbit Polyclonal Antibody
TA344738

USD 475.00

5 Days

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
PPP3CB Rabbit Polyclonal Antibody
TA308439

USD 415.00

5 Days

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)
PPP2R5A Rabbit Polyclonal Antibody
TA314377

USD 345.00

In Stock

Rabbit polyclonal anti-PPP2R5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A.
PPP2R1A Goat Polyclonal Antibody
TA311413

USD 375.00

5 Days

Goat Anti-PP2A / PPP2R1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2.
PPP2R1B Rabbit Polyclonal Antibody
TA314375

USD 345.00

4 Weeks

Rabbit polyclonal anti-PPP2R1B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B.
PPP3CB Rabbit Polyclonal Antibody
TA318865

USD 380.00

3 Weeks

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A
PP2A-alpha (PPP2CA) Goat Polyclonal Antibody
TA302738

USD 375.00

5 Days

Goat Polyclonal Antibody against PPP2CA / PPP2CB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1.
PPP2R5D Goat Polyclonal Antibody
TA302740

USD 375.00

5 Days

Goat Polyclonal Antibody against PPP2R5D

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236.
PPP2R5A Goat Polyclonal Antibody
TA302741

USD 375.00

5 Days

Goat Polyclonal Antibody against PPP2R5A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AYNMHSILSNTSAE, from the C Terminus of the protein sequence according to NP_006234.1.
PPP2R5B Rabbit Polyclonal Antibody
TA308613

USD 415.00

5 Days

Rabbit Polyclonal antibody to PPP2R5B (protein phosphatase 2, regulatory subunit B', beta isoform)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 434 and 497 of PPP2R5B (Uniprot ID#Q15173)
PPP2R5D Rabbit Polyclonal Antibody
TA312818

USD 345.00

4 Weeks

Rabbit polyclonal anti-PPP2R5D antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D.
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA326450

USD 385.00

5 Days

Rabbit Polyclonal Anti-Calcineurin A Antibody

Reactivities Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Calcineurin A peptide (AA 364-283)
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339197

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL
PP2A-beta (PPP2CB) Rabbit Polyclonal Antibody
TA323426

USD 345.00

4 Weeks

Anti-PPP2CB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 292-306 amino acids of Human protein phosphatase 2, catalytic subunit, beta isozyme
PP2A-beta (PPP2CB) Rabbit Polyclonal Antibody
TA323427

USD 345.00

In Stock

Anti-PPP2CB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 292-306 amino acids of Human protein phosphatase 2, catalytic subunit, beta isozyme
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA349733

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA350295

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA358331

USD 360.00

5 Days

PPP2CA Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated