Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Rabbit Polyclonal DcR2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DcR2 antibody was raised against a peptide corresponding to amino acids 249 to 263 of human DcR2 precursor. |
Rabbit polyclonal IL1R Antibody (C-term E487)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
Modifications | Phospho-specific |
Goat Polyclonal Anti-BAX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. |
Goat Polyclonal Antibody against BCL2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal anti-Bax antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Bax. |
Rabbit polyclonal anti-AIFM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM1. |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
Modifications | Phospho-specific |
TNFRSF10C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFRSF10C |
Rabbit Polyclonal Anti-Bax Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Goat Polyclonal Anti-Aurora Kinase B Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aurora Kinase B Antibody: Peptide with sequence YKELQKSCTFDEQ, from the internal region of the protein sequence according to NP_004208.2. |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit polyclonal TNF Receptor-1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T). |
Modifications | Phospho-specific |
Anti-TNFRSF10B Rabbit Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 186-200 amino acids of Human Tumor necrosis factor receptor superfamily member 10B |
Anti-BCL2L1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 1-210 amino acids of Human Bcl-2-like protein 1 |
Rabbit Polyclonal BCL-2 (Ser87) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 87 |
Modifications | Phospho-specific |
Rabbit Polyclonal BCL-XL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL |
Rabbit Polyclonal BCL-XL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL |
Rabbit Polyclonal BCL-XL (Ser62) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Serine 62 |
Modifications | Phospho-specific |
Rabbit Polyclonal BCL-XL (Thr47) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Threonine 47 |
Modifications | Phospho-specific |
Rabbit polyclonal BCL2 (Phospho-Ser70) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL2 around the phosphorylation site of serine 70 (R-T-SP-P-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit anti-BCL2 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCL2 |
Rabbit anti-AIFM1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AIFM1 |
Rabbit Polyclonal DcR1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DcR1 antibody was raised against a peptide corresponding to amino acids in a extracellular domain (ED) of human DcR1 precursor. |
Rabbit Polyclonal AIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF. |
Rabbit Polyclonal DcR1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DcR1 antibody was raised against a peptide corresponding to amino acids in the extracellular domain of human DcR1 precursor. |
Rabbit Polyclonal Bax Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Bax. |
Rabbit Polyclonal BCL-2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 |
Rabbit Polyclonal Trk A (Tyr680+Tyr681) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk A around the phosphorylation site of Tyrosine 680+Tyrosine 681 |
Modifications | Phospho-specific |
BCL2L1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCL2L1 |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Rabbit Polyclonal AIF Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine |
Conjugation | Unconjugated |
Immunogen | (aa 151-170); human |
Goat Anti-TNFRSF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1. |
Rabbit polyclonal anti-BCL-XL antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human BCL-XL. |
Rabbit polyclonal BCL-XL (Thr115) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL-XL around the phosphorylation site of threonine 115 (H-I-TP-P-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-BAX antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal Trk A (Phospho-Tyr757) antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 757 (E-V-YP-A-I). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TNF-R1 Antibody
Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Rabbit Polyclonal Anti-AIFM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AIFM1 antibody: synthetic peptide directed towards the middle region of human AIFM1. Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED |
Rabbit Polyclonal Bcl-xL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit anti BCL-2 (pThr129) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from epitope –FATVV- with the phosphorylation site Thr129 of human BCL-2 protein. This sequence is identical in human, rat, mouse, bovine and dog. |
Anti-BAX Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein |