Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
Rabbit anti-UGT2B7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT2B7 |
ALDH2 (N-term) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit anti-UGDH Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGDH |
Rabbit anti-UGT1A4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A4 |
Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS |
Rabbit Polyclonal Anti-UGT1A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Rabbit Polyclonal Anti-UGT2B15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
Goat Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
UGT2B15 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 163-193 amino acids from the Central region of human UGT2B15 |
Rabbit Polyclonal Antibody against ALDH2 (N-term)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224) |
Rabbit polyclonal anti-ALDH1B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1. |
Rabbit polyclonal anti-UGDH antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UGDH. |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR |
Rabbit Polyclonal Anti-ALDH1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALDH1B1 |
UDP glucose dehydrogenase (UGDH) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 464-494 amino acids from the C-terminal region of human UGDH |
Rabbit Polyclonal Aldh3A2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Goat Anti-ALDH2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DETQFKKILGYIN, from the internal region of the protein sequence according to NP_000681.2. |
Goat Anti-ALDH9A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3. |
Rabbit polyclonal Anti-UGT1A7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
UGT2B17 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human UDB17 |
Rabbit Polyclonal antibody to UGT2B7 (UDP glucuronosyltransferase 2 family, polypeptide B7)
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 278 of UGT2B7 (Uniprot ID#P16662) |
Goat Anti-ALDH1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Rabbit polyclonal Anti-UGT1A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Rabbit Polyclonal Anti-ALDH9A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC |
Rabbit Polyclonal Anti-UGDH Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ugdh antibody is: synthetic peptide directed towards the C-terminal region of Rat Ugdh. Synthetic peptide located within the following region: AFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVS |
Goat Anti-ALDH9A1, Biotinylated Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3. |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Rabbit Polyclonal Anti-UGT1A10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGT1A10 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALDH3A2 |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGT2B4 |
Rabbit Polyclonal Anti-UGT1A6 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UGT1A6 |
UGDH Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |