Antibodies

View as table Download

Rabbit Polyclonal Anti-PRMT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT7 antibody: synthetic peptide directed towards the N terminal of human PRMT7. Synthetic peptide located within the following region: MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ

1 star1 star1 star1 star½ star Reviews (2)

Anti-PRMT7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7

Goat Anti-PRMT7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRFGEINDQDRTDR, from the internal region of the protein sequence according to NP_061896.1; NP_001171753.1.

Rabbit Polyclonal PRMT7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Amino acids 346-360 of human PRMT7 were used as the immunogen.

Anti-PRMT7 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7

Prmt7 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

PRMT7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 513-692 of human PRMT7 (NP_061896.1).
Modifications Unmodified