Rabbit polyclonal HDAC4 (Ser632) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal HDAC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1049-1077 amino acids from the C-terminal region of human HDAC4. |
Rabbit Polyclonal HDAC4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 |
Phospho-HDAC4-S632 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S632 of human HDAC4 |
| Modifications | Phospho-specific |
Rabbit Polyclonal HDAC4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Anti-HDAC4/HDAC5/HDAC9 (phospho-Ser246/259/220) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 246/259/220 (T-A-S(p)-EP) derived from Human HDAC4/HDAC5/HDAC9. |
| Modifications | Phospho-specific |
Rabbit Polyclonal HDAC4 (Ser632) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC4 around the phosphorylation site of Serine 632 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Hdac4 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Rabbit anti-HDAC4 (Phospho-Ser632) polyclonal antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanHDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P). |
| Modifications | Phospho-specific |
Anti-HDAC4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 536-548 amino acids of Human histone deacetylase 4 |
Germany
Japan
United Kingdom
China
