Rabbit Polyclonal Anti-E2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3. |
Rabbit Polyclonal Anti-E2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3. |
Rabbit polyclonal MDM2 (Ab-166) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T). |
Phospho-RB1-S780 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S780 of human RB1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RB1 |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
Rabbit polyclonal Retinoblastoma (Ser608) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V). |
Modifications | Phospho-specific |
Anti-RB1 (Phospho-Ser795) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 795 (P-S-S(p)-P-L) derived from Human Rb. |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-E2F-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Rabbit Polyclonal Anti-E2F-2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F-2 Antibody: Peptide sequence around aa.425~429(L-F-D-S-Y) derived from Human E2F-2. |
Rabbit Polyclonal Anti-Phospho-Retinoblastoma(Thr826) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-Retinoblastoma(Thr826) Antibody: A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Threonine 826 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-E2F2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human E2F2. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433 |
Modifications | Phospho-specific |
Rabbit Polyclonal E2F1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 |
Rabbit Polyclonal MDM2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 around the phosphorylation site of Serine 166 |
Modifications | Phospho-specific |
Rabbit Polyclonal Retinoblastoma Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Retinoblastoma |
Rabbit Polyclonal Retinoblastoma (Ser780) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Serine 780 |
Modifications | Phospho-specific |
Rabbit Polyclonal Retinoblastoma (Ser807) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Serine 807 |
Modifications | Phospho-specific |
Rabbit polyclonal p53 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p53. |
Rabbit polyclonal p53 (Ab-378) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H). |
Rabbit Polyclonal Anti-E2F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2. Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI |
Anti-RB1 (Phospho-Ser807) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 807 (Y-I-S(p)-P-L) derived from Human Rb. |
Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
Modifications | Phospho-specific |
Rabbit Polyclonal Retinoblastoma (Ser795) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Serine 795 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 |
Mouse Monoclonal cleaved Retinoblastoma 1 Antibody (172C1094)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Rabbit anti p53 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human p53 protein |
Rabbit anti P53(pS15) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein |
Rabbit anti P53(pS37) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein |
Rabbit polyclonal Retinoblastoma (Ab-608) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V). |
Goat Polyclonal Anti-E2F3 (mouse) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | C Terminus of NP_034223.1 (DLEKLPLVEDFMCS) |
Anti-E2F1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Rabbit Polyclonal MDM2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2. |
Rabbit Polyclonal Anti-E2F3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK |
Rabbit Polyclonal Anti-TRP53 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRP53 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIR |
Rabbit anti E2F2 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to N-terminal of human E2F2. |
Rabbit anti Retinoblastoma Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse anti p53 Monoclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |