Anti-OLFM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-220 amino acids of human olfactomedin 1 |
Anti-OLFM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-220 amino acids of human olfactomedin 1 |
Rabbit Polyclonal Antibody against OLFM1 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-100 amino acids from the N-terminal region of human Olfm1. |
Rabbit Polyclonal Antibody against OLFM1 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 434-463 amino acids from the C-terminal region of human Olfm1. |
Mouse Monoclonal Anti-Pancortin Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OLFM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the N-terminal region of Human OLFM1. Synthetic peptide located within the following region: VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK |
Rabbit Polyclonal Anti-OLFM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the C-terminal region of Human OLFM1. Synthetic peptide located within the following region: EKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLA |
Rabbit Polyclonal Anti-OLFM1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OLFM1 |