Rabbit anti-PTBP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PTBP1 |
Rabbit anti-PTBP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PTBP1 |
Rabbit Polyclonal Anti-PTBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the N terminal of human PTBP1. Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI |
Rabbit Polyclonal Anti-PTBP1 Antibody
Applications | WB |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
PTBP1 (2-14) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from N-term of human PTBP1 |
Goat Polyclonal Antibody against PTBP1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DGIVPDIAVGTKR-C, from the N Terminus of the protein sequence according to NP_002810.1; NP_114367.1; NP_114368.1; NP_787041.1. |
Mouse Monoclonal anti-PTBP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |