Rabbit Polyclonal RUNX2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human RUNX2 protein (within residues 225-300). [Swiss-Prot Q13950] |
Rabbit Polyclonal RUNX2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human RUNX2 protein (within residues 225-300). [Swiss-Prot Q13950] |
Rabbit polyclonal RUNX2 Antibody (S533)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RUNX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids surrounding S533 of human RUNX2. |
RUNX2 mouse monoclonal antibody, clone 4D5, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
RUNX2 mouse monoclonal antibody, clone 1D2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
RUNX2 (251-351) mouse monoclonal antibody, clone 3F5
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Rabbit Polyclonal Anti-RUNX2 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the C terminal of human RUNX2. Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY |
RUNX2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human CBFA1 |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Chicken, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal Anti-RUNX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
Rabbit Polyclonal Anti-RUNX2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the N terminal of human RUNX2. Synthetic peptide located within the following region: MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQ |
Carrier-free (BSA/glycerol-free) RUNX2 mouse monoclonal antibody, clone OTI3E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CBFA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 320-336 amino acids of Human Core-binding factor subunit alpha-1 |
Rabbit Polyclonal Anti-RUNX2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RUNX2 |
RUNX2 mouse monoclonal antibody, clone OTI3E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
2 Weeks
RUNX2 mouse monoclonal antibody, clone OTI3E12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
RUNX2 mouse monoclonal antibody, clone OTI3E12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
RUNX2 mouse monoclonal antibody, clone OTI3E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-RUNX2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RUNX2 |
Rabbit polyclonal anti-RUNX2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RUNX2 |