Antibodies

View as table Download

ALOX15 mouse monoclonal antibody, clone 3D8, Purified

Applications ELISA, IHC, WB
Reactivities Human

Goat Anti-ALOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3.

Rabbit polyclonal Anti-ALOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15 antibody: synthetic peptide directed towards the middle region of human ALOX15. Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Rabbit anti 15-Lox-1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ALOX15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALOX15

ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Biotin

ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation HRP

ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".