Rabbit Polyclonal TANK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TANK antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TANK. |
Rabbit Polyclonal TANK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TANK antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TANK. |
Rabbit Polyclonal TANK Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TANK antibody was raised against a 14 amino acid peptide from near the amino terminus of human TANK. |
Rabbit Polyclonal anti-TANK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ |
Rabbit Polyclonal Anti-TANK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH |
Rabbit Polyclonal Anti-TANK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ |
Carrier-free (BSA/glycerol-free) TANK mouse monoclonal antibody,clone OTI1G2
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
TANK mouse monoclonal antibody,clone OTI1G2
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
TANK mouse monoclonal antibody,clone OTI1G2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
TANK mouse monoclonal antibody,clone OTI1G2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
TANK mouse monoclonal antibody,clone OTI1G2
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |