Antibodies

View as table Download

Rabbit Polyclonal TANK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TANK.

Rabbit Polyclonal TANK Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TANK antibody was raised against a 14 amino acid peptide from near the amino terminus of human TANK.

Rabbit Polyclonal anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH

Rabbit Polyclonal Anti-TANK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ

Carrier-free (BSA/glycerol-free) TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

TANK mouse monoclonal antibody,clone OTI1G2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated