Mouse Monoclonal LMO2 Antibody (1A9-3B11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal LMO2 Antibody (1A9-3B11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against LMO2(clone EP3257)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal LMO2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of the human LMO2 protein (within residues 1-100). [Swiss-Prot# P25791] |
Mouse Anti-Human LMO2 Purified (25 ug)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-LMO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS |
Rabbit Polyclonal Anti-LMO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE |
Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human LMO2 (NP_001135788.1). |
Modifications | Unmodified |
LMO2 Rabbit polyclonal Antibody
Applications | FC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human LMO2 |
LMO2 Rabbit monoclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody,clone 1G10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LMO2 mouse monoclonal antibody,clone 1G10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody,clone 1D7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LMO2 mouse monoclonal antibody,clone 1D7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody,clone 1C8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LMO2 mouse monoclonal antibody,clone 1C8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LMO2 mouse monoclonal antibody,clone 2D7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LMO2 mouse monoclonal antibody,clone 2D7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |