Rabbit Polyclonal Anti-PRMT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT7 antibody: synthetic peptide directed towards the N terminal of human PRMT7. Synthetic peptide located within the following region: MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ |
Anti-PRMT7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7 |
Goat Anti-PRMT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRFGEINDQDRTDR, from the internal region of the protein sequence according to NP_061896.1; NP_001171753.1. |
Rabbit Polyclonal PRMT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 346-360 of human PRMT7 were used as the immunogen. |
Carrier-free (BSA/glycerol-free) PRMT7 mouse monoclonal antibody,clone OTI9B7
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT7 mouse monoclonal antibody,clone OTI10A8
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Anti-PRMT7 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 526-692 amino acids of human protein arginine methyltransferase 7 |
PRMT7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 513-692 of human PRMT7 (NP_061896.1). |
| Modifications | Unmodified |
PRMT7 mouse monoclonal antibody,clone OTI9B7
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT7 mouse monoclonal antibody,clone OTI9B7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
PRMT7 mouse monoclonal antibody,clone OTI9B7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
PRMT7 mouse monoclonal antibody,clone OTI9B7
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PRMT7 mouse monoclonal antibody,clone OTI10A8
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PRMT7 mouse monoclonal antibody,clone OTI10A8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
PRMT7 mouse monoclonal antibody,clone OTI10A8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
PRMT7 mouse monoclonal antibody,clone OTI10A8
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
