Antibodies

Jump to Filters
View as table Download
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA383351

USD 275.00

3 Weeks

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human WT1 (NP_001185480.1).
Modifications Unmodified
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA383351S

USD 85.00

3 Weeks

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human WT1 (NP_001185480.1).
Modifications Unmodified
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA383352

USD 275.00

3 Weeks

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Modifications Unmodified
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA383352S

USD 85.00

3 Weeks

WT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Modifications Unmodified
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA326990

USD 275.00

3 Weeks

WT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335174

USD 375.00

In Stock

Rabbit Polyclonal Anti-WT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the middle region of human WT1. Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Wilms Tumor Protein (WT1) (Center) Rabbit Polyclonal Antibody
AP54572PU-N

USD 450.00

2 Weeks

Wilms Tumor Protein (WT1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 353-383 (E361) amino acids from the Central region of human WT1
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA308577

USD 415.00

In Stock

Rabbit polyclonal antibody to WT1 (Wilms tumor 1)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 449 of Wilms Tumor 1 (Uniprot ID#P19544)
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA329197

USD 375.00

5 Days

Rabbit Polyclonal anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WT1 antibody is: synthetic peptide directed towards the N-terminal region of Human WT1. Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC
Wilms Tumor Protein (WT1) Goat Polyclonal Antibody
TA302633

USD 375.00

5 Days

Goat Polyclonal Antibody against Wilms tumor 1 / WT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QDPASTCVPEPASQH, from the N Terminus of the protein sequence according to NP_000369.3; NP_077742.2; NP_077743.2; NP_077744.3.
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA335173

USD 375.00

5 Days

Rabbit Polyclonal Anti-WT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WT1 antibody: synthetic peptide directed towards the N terminal of human WT1. Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA
Wilms Tumor Protein (WT1) Rabbit Polyclonal Antibody
TA383353

USD 220.00

3 Weeks

WT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human WT1.