CIITA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CIITA |
CIITA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CIITA |
Rabbit polyclonal anti-CIITA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
CIITA (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal anti-CIITA antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CIITA. |
Rabbit Polyclonal CIITA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA. |
Rabbit Polyclonal Anti-CIITA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CIITA antibody: synthetic peptide directed towards the middle region of human CIITA. Synthetic peptide located within the following region: YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR |
CIITA rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-Ciita Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
Carrier-free (BSA/glycerol-free) CIITA mouse monoclonal antibody,clone OTI7B12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CIITA Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human CIITA (NP_000237.2). |
Modifications | Unmodified |
CIITA mouse monoclonal antibody,clone OTI7B12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CIITA mouse monoclonal antibody,clone OTI7B12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
CIITA mouse monoclonal antibody,clone OTI7B12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CIITA mouse monoclonal antibody,clone OTI7B12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".