Antibodies

Jump to Filters
View as table Download
Klotho (KL) Rabbit Polyclonal Antibody
TA319778

USD 430.00

2 Weeks

Rabbit Polyclonal KLOTHO Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLOTHO antibody was raised against a 16 amino acid synthetic peptide near the center of human KLOTHO.
Klotho (KL) Rabbit Polyclonal Antibody
TA346109

USD 475.00

5 Days

Rabbit Polyclonal Anti-KL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
Klotho (KL) Rabbit Polyclonal Antibody
TA346110

USD 475.00

5 Days

Rabbit Polyclonal Anti-KL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE
Klotho (KL) Rabbit Polyclonal Antibody
TA346111

USD 475.00

5 Days

Rabbit Polyclonal Anti-KL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD
Klotho (KL) Goat Polyclonal Antibody
TA311313

USD 375.00

2 Weeks

Goat Anti-Klotho (KL) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRDDAKYMYYLKK, from the internal region of the protein sequence according to NP_004786.2; NP_710150.1.
Klotho (KL) Rabbit Polyclonal Antibody
TA350910

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-KL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KL
Kl Rabbit Polyclonal Antibody
TA355850

USD 360.00

5 Days

Kl Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Klotho (KL) Rabbit Polyclonal Antibody
TA377828

USD 220.00

3 Weeks

KL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KL (NP_004786.2).
Modifications Unmodified
Klotho (KL) Rabbit Polyclonal Antibody
TA388941

USD 350.00

5 Days

Klotho Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Produced from sera of rabbits pre-immunized with highly pure recombinant Human Klotho. Anti-Human Klotho specific antibody was purified by affinity chromatography employing immobilized Human Klotho matrix.
Klotho (KL) Rabbit Polyclonal Antibody
TA388942

USD 350.00

5 Days

Klotho Antibody (biotin)

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hKlotho. Anti-Human Klotho specific antibody was purified by affinity chromatography and then biotinylated.