SLAMF1 mouse monoclonal antibody, clone SLAM.4, Azide Free
Applications | FC, IF, IP |
Reactivities | Human |
SLAMF1 mouse monoclonal antibody, clone SLAM.4, Azide Free
Applications | FC, IF, IP |
Reactivities | Human |
Rabbit Polyclonal SLAMF1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SLAMF1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human SLAMF1. |
Rabbit polyclonal anti-SLAM/CD150 antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Amino acids corresponding to 138-153 of human SLAM |
Rat Anti-Mouse CD150 Purified (100 ug)
Applications | FC |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SLAMF1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR |
Rabbit Polyclonal Anti-SLAMF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SLAMF1 |
SLAMF1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SLAMF1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-237 of human SLAMF1 (NP_003028.1). |
Modifications | Unmodified |