Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TNFRSF9 Antibody
| Applications | WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNFRSF9 mouse monoclonal antibody,clone OTI2B11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
4-1BB/CD137 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human 4-1BB/CD137 (NP_001552.2). |
| Modifications | Unmodified |
Recombinant Anti-4-1BB (Clone LOB12.3)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-4-1BB (Clone LOB12.3)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-4-1BB (Clone 4B4-1-1)
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-4-1BB (Clone 4B4-1-1)
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 5H5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 5H5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF9 mouse monoclonal antibody,clone OTI5H5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 7F9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
TNFRSF9 mouse monoclonal antibody,clone 7F9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF9 mouse monoclonal antibody,clone OTI7F9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11, Biotinylated
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TNFRSF9 mouse monoclonal antibody,clone OTI2B11, HRP conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | HRP |
TNFRSF9 mouse monoclonal antibody,clone OTI2B11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Category
- Antibodies
Target Symbol
- TNFRSF9
Filter by
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unmodified (1)