Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal anti-Actin-gamma2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Actin-?2.

Anti-RHOA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A

Rabbit Polyclonal Anti-MYLK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.

Rabbit Polyclonal Anti-CALCRL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL

Rabbit Polyclonal Anti-alpha-SMA antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-alpha-SMA antibody: Synthetic peptide corresponding to N terminal residues of Human alpha smooth muscle Actin.

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1

Rabbit Polyclonal Anti-MRVI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MRVI1 antibody is: synthetic peptide directed towards the N-terminal region of Human MRVI1. Synthetic peptide located within the following region: LVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPS

Anti-ADCY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain)

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL

Rabbit Polyclonal Anti-NPR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NPR2

Rabbit Polyclonal anti-BRAF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BRAF

Rabbit Polyclonal anti-BRAF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BRAF