Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Claudin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Anti-vinculin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin |
Rabbit Polyclonal Anti-SDF 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1 |
Rabbit Polyclonal Anti-RhoH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RhoH Antibody: A synthesized peptide derived from human RhoH |
Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) . |
| Modifications | Phospho-specific |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
Rabbit Polyclonal Anti-ACTIN Antibody
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Arabidopsis thaliana actin |
Rabbit Polyclonal Anti-MYL2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYL2 |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit polyclonal p47 phox/NCF1 (Ab-345) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 345 (P-Q-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal NCF1/Neutrophil Cytosol Factor 1 (Ser304)(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neutrophil Cytosol Factor 1 around the phosphorylation site of serine 304 (R-S-SP-I-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal p47 phox/NCF1 (Ab-359) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p47 phox around the phosphorylation site of serine 359 (Q-R-SP-K-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal p130 Cas (Tyr410) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human: Tyr410, Mouse: Tyr414, Rat: Tyr508 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p130 Cas around the phosphorylation site of tyrosine 410 (G-V-YP-A-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal Claudin 7 (Ab-210) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V). |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 177-189 amino acids of Human ras homolog family member A |
Anti-PTK2B (Phospho-Tyr402) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 402 (D-I-Y(p)-A-E) derived from Human Pyk2. |
| Modifications | Phospho-specific |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
Rabbit Polyclonal VE-Cadherin (Tyr731) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VE-Cadherin around the phosphorylation site of Tyrosine 731 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p38 MAPK (Tyr322) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 322 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
| Modifications | Phospho-specific |
USD 345.00
In Stock
CLDN7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN7 |
Rabbit anti-MMP9 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MMP9 |
CLDN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDN1 |
Rabbit Polyclonal VAV1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VAV1 |
Rabbit Polyclonal Anti-CYBA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP |
Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA |
Rabbit Polyclonal Anti-ACTN3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |
Rabbit Polyclonal Anti-PECAM-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PECAM-1 Antibody: A synthesized peptide derived from human PECAM-1 |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Claudin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 1 Antibody: A synthesized peptide derived from human Claudin 1 |
Rabbit Polyclonal Anti-Claudin 3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 3 Antibody: A synthesized peptide derived from human Claudin 3 |
Rabbit Polyclonal Anti-Claudin 10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 10 Antibody: A synthesized peptide derived from human Claudin 10 |
Active filters
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- Leukocyte transendothelial migration
Filter by
Category
Target Symbol
- CTNNB1 (21)
- EZR (20)
- ACTB (19)
- MAPK14 (18)
- PXN (16)
- PTPN11 (14)
- CXCR4 (13)
- ROCK2 (13)
- VASP (13)
- ICAM1 (12)
- PTK2 (12)
- PECAM1 (11)
- PRKCA (11)
- PRKCB (11)
- CLDN7 (10)
- MMP9 (10)
- PLCG1 (10)
- SHC1 (10)
- VCL (10)
- BCAR1 (9)
- CDH5 (9)
- CLDN1 (9)
- CTNNA1 (9)
- MMP2 (9)
- NCF1 (9)
- PIK3R1 (9)
- PLCG2 (9)
- PTK2B (9)
- CLDN5 (8)
- CTNND1 (8)
- ITGB1 (8)
- VAV1 (8)
- CLDN11 (7)
- CLDN3 (7)
- CLDN4 (7)
- CXCL12 (7)
- RHOA (7)
- VCAM1 (7)
- CLDN10 (6)
- CYBB (6)
- ITGA4 (6)
- ITGAM (6)
- MSN (6)
- THY1 (6)
- ACTG1 (5)
- ACTN1 (5)
- ACTN2 (5)
- ACTN4 (5)
- CDC42 (5)
- F11R (5)
- NOX1 (5)
- PRKCG (5)
- RAC1 (5)
- ROCK1 (5)
- SIPA1 (5)
- ACTN3 (4)
- CD99 (4)
- CLDN14 (4)
- CLDN19 (4)
- ITGB2 (4)
- MAPK12 (4)
- NCF4 (4)
- NOX3 (4)
- PIK3CA (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- RAP1A (4)
- RAPGEF3 (4)
- CLDN18 (3)
- CLDN2 (3)
- CLDN6 (3)
- CLDN8 (3)
- GNAI2 (3)
- GNAI3 (3)
- ITGAL (3)
- JAM2 (3)
- MYL9 (3)
- NCF2 (3)
- PIK3CD (3)
- RAP1B (3)
- VAV3 (3)
- ARHGAP35 (2)
- CLDN15 (2)
- CLDN16 (2)
- CLDN23 (2)
- CYBA (2)
- ITK (2)
- JAM3 (2)
- MAPK11 (2)
- MYL12B (2)
- MYL2 (2)
- RAC2 (2)
- RASSF5 (2)
- RHOH (2)
- VAV2 (2)
- AFDN (1)
- ARHGAP5 (1)
- CLDN17 (1)
- CLDN9 (1)
Reactivities
- Human (632)
- Mouse (471)
- Rat (396)
- Dog (27)
- Bovine (19)
- Chicken (15)
- Pig (15)
- Cow (13)
- Monkey (11)
- Rabbit (7)
- Canis (6)
- Rhesus Monkey (5)
- Xenopus (5)
- Canine (4)
- Drosophila (3)
- Sheep (3)
- Guinea Pig (2)
- Hamster (2)
- Horse (2)
- X. tropicalis (2)
- Zebrafish (2)
- Avian (1)
- Bat (1)
- C. elegans (1)
- Chimpanzee (1)
- Gibbon (1)
- Gorilla (1)
- Orang-Utan (1)
- Porcine (1)