Antibodies

View as table Download

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HDAC8

Rabbit anti-HDAC8 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HDAC8

Rabbit Polyclonal HDAC8 (Ser39) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC8 around the phosphorylation site of Serine 39
Modifications Phospho-specific

Rabbit Polyclonal HDAC8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC8

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the C terminal of human HDAC8. Synthetic peptide located within the following region: TGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNY

Rabbit anti-HDAC8 (Phospho-Ser39) polyclonal antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanHDAC8 around the phosphorylation site of serine 39 (R-A-SP-M-V).
Modifications Phospho-specific

Rabbit polyclonal anti-HDAC8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 10 of mouse HDAC-8

Rabbit polyclonal anti-HDAC8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human HDAC8

Rabbit Polyclonal Anti-HDAC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the N terminal of human HDAC8. Synthetic peptide located within the following region: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYAL

HDAC8 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HDAC8

HDAC8 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HDAC8