Antibodies

Jump to Filters
View as table Download
SIRT6 Rabbit Polyclonal Antibody
TA336289

USD 430.00

5 Days

Rabbit Polyclonal SIRT6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the mouse SIRT6 protein (within residues 250-334). [Swiss-Prot P59941]
SIRT6 Rabbit Polyclonal Antibody
TA301524

USD 424.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human SIRT6 protein (within residues 300-355). [Swiss-Prot Q8N6T7]
SIRT6 Rabbit Polyclonal Antibody
TA301523

USD 424.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human SIRT6 protein (within residues 250-350). [Swiss-Prot Q8N6T7]
SIRT6 Chicken Polyclonal Antibody
TA319931

USD 430.00

5 Days

Chicken Polyclonal SIRT6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRT6 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SIRT6.
SIRT6 Rabbit Polyclonal Antibody
TA330290

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the middle region of human SIRT6. Synthetic peptide located within the following region: TRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVP
SIRT6 Rabbit Polyclonal Antibody
TA330291

USD 310.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
SIRT6 Rabbit Polyclonal Antibody
TA324068

USD 345.00

In Stock

Anti-SIRT6 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 35-274 amino acids of human sirtuin 6