Rabbit Polyclonal Anti-XPO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO1 antibody: synthetic peptide directed towards the C terminal of human XPO1. Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH |
Rabbit Polyclonal Anti-XPO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO1 antibody: synthetic peptide directed towards the middle region of human XPO1. Synthetic peptide located within the following region: IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP |
CRM1 (XPO1) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human XPO1 |
Germany
Japan
United Kingdom
China
