Antibodies

View as table Download

Rabbit anti-CFP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CFP

Properdin (CFP) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Properdin (CFP) goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The antigen has been isolated from pooled Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Properdin (CFP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203~233 amino acids from the Central region of human CFP

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the N terminal of human CFP. Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Rabbit Polyclonal Anti-CFP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFP antibody: synthetic peptide directed towards the middle region of human CFP. Synthetic peptide located within the following region: SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE