Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
Rabbit Polyclonal MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit anti-PIAS2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PIAS2 |
c-Myc (MYC) chicken polyclonal antibody, FITC
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | FITC |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
Rabbit Polyclonal c-Myc Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal Anti-PIAS2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2 |
Rabbit Polyclonal Anti-MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | CCND1 antibody was raised against kLH conjugated synthetic peptide corresponding to amino acid residues surrounding S90 of human Cyclin D1. |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Conjugation | Biotin |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
Applications | ELISA, IHC, WB |
Conjugation | HRP |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Rabbit polyclonal anti-PIAS2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIAS2. |
Rabbit Polyclonal PIAS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2. |
Rabbit Polyclonal Cyclin D1 Antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
Modifications | Phospho-specific |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58 |
Modifications | Phospho-specific |
PIAS2 (431-445) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Canine, Equine, Human, Rabbit |
Immunogen | Synthetic peptide from an internal region of human PIAS2 |
PIAS2 (185-196) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
c-Myc (MYC) rabbit polyclonal antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against MYC (T58)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC. |
Rabbit Polyclonal Antibody against MYC (S62)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-69 amino acids from human MYC. |
Rabbit Polyclonal Antibody against MYC (S373)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 351-380 amino acids from human MYC. |
Goat Anti-PIAS2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit Polyclonal Cyclin D1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 |
Rabbit Polyclonal MYC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Pias2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
Rabbit anti Myc-Tag Polyclonal Antibody
Applications | WB |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of EQKLISEEDL conjugated to a carrier protein. |
c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S). |
c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified
Applications | IF |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S). |
Cyclin D1 (CCND1) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CCND1 |
Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1 |
Rabbit polyclonal Cyclin D1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Cyclin D1 was produced by repeated immunizations of full length fusion protein corresponding to the human gene sequence. |
Rabbit polyclonal CCND1 Antibody (C-term T288)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CCND1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 267-294 amino acids from the C-terminal region of human CCND1. |
Goat Anti-cyclin D1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1 |
Rabbit Polyclonal Anti-PIAS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIAS2 Antibody: synthetic peptide directed towards the N terminal of human PIAS2. Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST |
Rabbit Polyclonal Anti-PIAS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: LTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD |
Rabbit Polyclonal Anti-PIAS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI |
Rabbit anti Cyclin D1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat. |
Rabbit anti c-Myc Polyclonal Antibody
Conjugation | Unconjugated |
Rabbit anti Myc(pT358) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti Myc(pT58) Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |