Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-NR1I3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I3. |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3. Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the middle region of human NR1I3. Synthetic peptide located within the following region: PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS |
Rabbit Polyclonal Anti-NR1I3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3. Synthetic peptide located within the following region: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQS |
NR1I3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NR1I3 |
NR1I3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1I3. |
Active filters
Target Symbol
- NR1I3
Isotypes
- IgG
Clonalities
- Polyclonal