Antibodies

View as table Download

Rabbit Polyclonal Anti-MINA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK

Rabbit Polyclonal Anti-MINA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK

Rabbit Polyclonal MINA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MINA antibody was raised against a 15 amino acid peptide near the amino terminus of human MINA.

Rabbit Polyclonal Anti-MINA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA. Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV

Rabbit Polyclonal anti-MINA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MINA antibody is: synthetic peptide directed towards the C-terminal region of Human MINA. Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH

Rabbit Polyclonal anti-MINA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: NGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWRIQEKLEC

RIOX2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RIOX2

RIOX2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RIOX2

RIOX2/MINA53 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human RIOX2/RIOX2/MINA5353 (NP_694822.2).
Modifications Unmodified