Antibodies

View as table Download

ATG16L1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG16L1

Rabbit anti-ATG16L1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATG16L1

Rabbit polyclonal ATG16L Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ATG16L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 161-190 amino acids from human ATG16L.

ATG16L1 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ATG16L1 antibody was raised against 18 amino acid peptide from near the amino terminus of human ATG16

ATG16L1 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ATG16L1 antibody was raised against 18 amino acid peptide from near the center of human ATG16

Rabbit Polyclonal ATG16 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG16 antibody was raised against a 18 amino acid peptide from near the amino terminus of human ATG16.

Rabbit Polyclonal ATG16 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG16 antibody was raised against a 18 amino acid peptide from near the center of human ATG16.

Rabbit Polyclonal Anti-ATG16L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the N terminal of human ATG16L1. Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ

Goat Anti-ATG16L1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KVEKVLSKQHSSSIN, from the internal region (near the C Terminus) of the protein sequence according to NP_110430.5; NP_060444.3.

Rabbit polyclonal anti-ATG16L1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human ATG16L1.

Rabbit Polyclonal Anti-ATG16L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the middle region of human ATG16L1. Synthetic peptide located within the following region: TSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPG

Rabbit Polyclonal Anti-ATG16L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG16L1 Antibody: synthetic peptide directed towards the middle region of human ATG16L1. Synthetic peptide located within the following region: RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

Rabbit Polyclonal ATG16L1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide within residues 1-100 of human ATG16L1 protein. [Swiss-Prot# Q676U5]

Rabbit Polyclonal ATG16L1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide within residues 1-100 of mouse ATG16L1. [Swiss-Prot# Q8C0J2]

ATG16L1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG16L1

ATG16L1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5).
Modifications Unmodified