Antibodies

Jump to Filters
View as table Download
GNAL Rabbit Polyclonal Antibody
AP01477PU-N

USD 370.00

2 Weeks

GNAL rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human Gα olf.
GNAL Rabbit Polyclonal Antibody
TA313932

USD 345.00

4 Weeks

Rabbit polyclonal anti-GNAL antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GNAL.
GNAL Rabbit Polyclonal Antibody
TA335039

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAL antibody: synthetic peptide directed towards the C terminal of human GNAL. Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
GNAL Rabbit Polyclonal Antibody
TA376639

USD 220.00

3 Weeks

GNAL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GNAL (NP_892023.1).
Modifications Unmodified
GNAL Rabbit Polyclonal Antibody
TA376640

USD 220.00

3 Weeks

GNAL Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GNAL (NP_892023.1).
Modifications Unmodified