Antibodies

View as table Download

NCR1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCR1

Rabbit Polyclonal Anti-Gps2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN

NCR1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit polyclonal anti-NCR1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCR1.

Rabbit Polyclonal Anti-NCR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCR1

NCR1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

NCR1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

NCR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCR1

NCR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2).
Modifications Unmodified

NCR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2).
Modifications Unmodified