Rabbit anti-BIRC7 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BIRC7 |
Rabbit anti-BIRC7 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BIRC7 |
Rabbit Polyclonal Livin Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Livin antibody was raised with a synthetic peptide corresponding to amino acids 264 to 280 of the short form and 281 to 298 of the long form of human Livin (1,3) This sequence is identical between a and b forms of the Livin proteins . |
Rabbit polyclonal antibody to ML-IAP (baculoviral IAP repeat-containing 7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 241 of Livin (Uniprot ID#Q96CA5) |
Goat Polyclonal Antibody against LIVIN / BIRC7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RAPVRSRVRT, from the C Terminus of the protein sequence according to NP_647478.1; NP_071444.1. |
Rabbit Polyclonal Anti-BIRC7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BIRC7 antibody: synthetic peptide directed towards the middle region of human BIRC7. Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL |
Mouse Monoclonal Livin Antibody (88C570)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BIRC7 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BIRC7 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-BIRC7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |