Antibodies

View as table Download

Mouse Monoclonal LMO2 Antibody (1A9-3B11)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal antibody against LMO2(clone EP3257)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal LMO2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human LMO2 protein (within residues 1-100). [Swiss-Prot# P25791]

Mouse Anti-Human LMO2 Purified (25 ug)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LMO2 antibody is: synthetic peptide directed towards the N-terminal region of Human LMO2. Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS

Rabbit Polyclonal Anti-LMO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LMO2 antibody: synthetic peptide directed towards the N terminal of human LMO2. Synthetic peptide located within the following region: GGGARAPEGVRAPAAGQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEE

Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LMO2 mouse monoclonal antibody, clone OTI2D7 (formerly 2D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated