Antibodies

View as table Download

Rabbit Polyclonal SIRP alpha Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid.

Rabbit Polyclonal Anti-SHPS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1

Rabbit polyclonal anti-Sirp a1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human SIRP-alpha1.

Rabbit Polyclonal Anti-SIRPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRPA antibody: synthetic peptide directed towards the C terminal of human SIRPA. Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody,clone OTI1G4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody, clone OTI7B3 (formerly 7B3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIRPA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody,clone OTI1G4

Applications WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody,clone OTI1G4

Applications WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody, clone OTI7B3 (formerly 7B3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody, clone OTI7B3 (formerly 7B3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SIRPA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated