Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ |
Rabbit Polyclonal Anti-ARIH2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG |
Rabbit Polyclonal Anti-ARIH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARIH2 Antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: EDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCL |
Goat Anti-ARIH2 / TRIAD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQRRRTLLKDFHDT, from the C Terminus of the protein sequence according to NP_006312.1. |
Rabbit Polyclonal Anti-ARIH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ARIH2 |
ARIH2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARIH2 |
Germany
Japan
United Kingdom
China
