Antibodies

View as table Download

POLR2A Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2A

Rabbit polyclonal POLR2A (Ab-1619) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S).

Rabbit Polyclonal Anti-POLR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ

POLR2A Rabbit polyclonal Antibody

Applications ChIP, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human POLR2A (NP_000928.1).
Modifications Unmodified

Phospho-POLR2A-S2 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S2 of human POLR2A
Modifications Phospho S2

Phospho-POLR2A-S5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S5 of human POLR2A
Modifications Phospho S5

Phospho-POLR2A-S7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around of human Phospho-POLR2A-S7.
Modifications Phospho S7

Rpb1 (phospho-S1619) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human Rpb1 around the phosphorylation site of Serine 1619.