Rabbit polyclonal anti-Sts-1 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminus of mouse Sts-1. |
Rabbit Polyclonal Anti-UBASH3B Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ubash3b antibody is: synthetic peptide directed towards the C-terminal region of Rat Ubash3b. Synthetic peptide located within the following region: AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL |
UBASH3B Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human UBASH3B (NP_116262.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China