Antibodies

View as table Download

GLUD1 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%).

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.

Rabbit polyclonal GLS Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS.

GLUD1 Rabbit anti-Bovine Polyclonal Antibody

Applications IHC
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase.

Rabbit Polyclonal GLS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Rabbit Polyclonal Anti-GLS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

Rabbit Polyclonal Anti-GLUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR

Rabbit Polyclonal Anti-GLUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-GLS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLS

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated